Pay in 4 interest-free payments of $179.23 Learn more
Ships within 48 hours · Estimated delivery Aug 30 - Sep 4
their capping and polyadenylation
IFNG and IL4 (through the regulation of CREB and MEF2)
Gene Names:Name:MRS2-D Ordered Locus Names:Os04g0430900
AA Sequence:MATRGGPMVAGTDGNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFVMLAKLTSDIL DHLDIFVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAARGNKVREMQKYMVAILLFAIL PLFYCFAYYFSDVWEFATLDKSVELDETDIFVWRGYPYGVFWYAFCFVGFQVHGFTLYFA YNLVKAWKARTATRKFQ
Human Tumor necrosis factor receptor superfamily member 18(TNFRSF18) ELISA kit Polypropylene their capping and polyadenylationSize: 96 Tests. Other sizes are also available. Please Inquire. Research topic: Immunology Uniprot ID: Q9Y5U5 Species: Human Former Code: Alias: AITR, GITR, GITR D, TNF receptor superfamily activation inducible protein activation inducible TNFR family receptor glucocorticoid induced TNFR related protein Product Type: ELISA Kit Sample Type: serum, plasma, tissue homogenates Detect Range: 0. 625 ng ml 40 ng ml Sensitivity: 0. 156 ng ml Antigen Name:
US$ 69.99
US$ 59.95
US$ 1050.00
US$ 10.00
US$ 89.00
